Protein s100a4
Webb18 dec. 2024 · S100A4 termination signal Introduction Liver consists of various hepatic cells, including hepatocytes, biliary epithelial cells, sinusoidal endothelial cells, stellate cells, and Kupffer cells, which perform principal functions including detoxification, protein synthesis, and production of biochemical molecules necessary for digestion. WebbS100A4 ELISA Kit. Members of the S100 protein family are low molecular mass acidic proteins characterized by cell-type-specific expression and the presence of 2 EF-hand …
Protein s100a4
Did you know?
WebbS100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as … Webb21 mars 2024 · GeneCards Summary for S100A1 Gene. S100A1 (S100 Calcium Binding Protein A1) is a Protein Coding gene. Diseases associated with S100A1 include …
WebbFigure 1 Analysis of S100A4, E-cadherin, and p53 after S100A4-siRNA treatment in A549 cell lines. Notes: (A) Western blot images of S100A4, E-cadherin, and p53 protein at 24 and 48 hours.(B) S100A4 protein levels calculated by Western blot analyses to determine the effect of treatment with siRNAs at 24 and 48 hours.(C) Detection of E-cadherin and p53 … Webb23 apr. 2024 · Expression of the calcium-binding protein S100A4 is markedly up-regulated by osmotic stress and is involved in the renal osmoadaptive response. J Biol Chem. …
Webb12 apr. 2024 · The small acidic EF-hand calcium-binding protein (S100A4) is another factor involved in tumor progression in several types of cancer. Melanoma cell lines express S100A4 in the extracellular region. It autocrinely stimulates the prometastatic activation of melanoma cells by interacting with the receptor for advanced glycation end product … WebbProduct Description: Mouse monoclonal antibody raised against a full-length recombinant S100A4. Immunogen: S100A4 (AAH16300, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK …
Webb4 apr. 2024 · Background Silicosis is a chronic occupational pulmonary disease characterized by persistent inflammation and irreversible fibrosis. Considerable …
Webb8 maj 2024 · S100 calcium-binding protein A4 (S100A4)/fibroblast-specific protein-1 (Fsp1) belongs to the S100 calcium-binding protein family and is considered a marker of … soho dining loungeWebb12 apr. 2024 · protein S100-A4, S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog), calcium placental protein, fibroblast … soho dock dual screenWebbS100A4, also known as Fibroblast-specific Protein 1, is a member of the Ca2+- dependent S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 is a … soho douchewandWebbS100 Calcium Binding Protein A4 (S100A4) belongs to the S100 calcium-binding protein family and is highly expressed in the bone marrow, lymphoid tissues, and lungs. … soho directionsWebbNX_P26447 - S100A4 - Protein S100-A4 - Function. Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, … soho down bandWebbHere we show that the S100A4 protein, mostly studied in cancer, is overexpressed in the damaged human and rodent brain and released … slp prompting hierarchyWebb9 mars 2024 · The significance of serum S100 calcium-binding protein A4 in silicosis. S100A4 Is a Strong Negative Prognostic Marker and Potential Therapeutic Target in … soho district london